Inactive
Notice ID:RFQ-0008-43YK-20
Synthetic RL-37 antimicrobial peptide-100g gross peptide, ? 95% purity, TFA counter ion exchange to acetate salt. Sequence: NH2-RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS-COOH. Previous assessment of the a...
Synthetic RL-37 antimicrobial peptide-100g gross peptide, ? 95% purity, TFA counter ion exchange to acetate salt. Sequence: NH2-RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS-COOH. Previous assessment of the antimicrobial effects of this peptide against select bacterial targets, of hemolytic activity on mammalian red blood cells, and protease inhibition/thermostability of peptide activity have all been validated from this manufacturer in our previous studies. The government anticipates award of a contract resulting from this solicitation to the responsible offeror whose offer conforming to the specifications will be most advantageous to the Government. PAYMENT: Any award made under this solicitation is subject to 31 CFR Part 208 which requires all payments made by the government to be made by electronic funds transfer. Please note on your proposal if you will accept a government purchase (Mastercard) card. This solicitation incorporates the following FAR clauses, provisions, and addendums: 52-212-1 Instructions to Offerors-Commercial Item; 52.212-3 Offeror Representations and Certifications-Commercial Items – annual representations and certifications are required. Offers shall include a statement as follows on their offer: the offeror verifies by submission of this offer that the representations and certifications currently posted electronically at https://www.sam.gov have been entered or updated in the last 12 months, are current, accurate, complete, and applicable to this solicitation (including the business size standard applicable to the NAICS code referenced for this solicitation), as of the date of this offer and are incorporated in this offer by reference, except for paragraphs ______________; 52.212-4 Contract Terms and Conditions-Commercial Items; 52.212-5 Contract Terms and Conditions Required to Implement Statues or Executive Orders-Commercial Items. In paragraph B of 52.212-5, the following apply: 52.219-28, 52.222-3, 52.222-19, 52.222-21, 52.222-26, 52.222-36, 52.225-3, 52.225-13, and 52.225-33. In the event the vendor will accept payment via the Government Purchase Card (Mastercard), the vendor shall annotate on its offer that it will accept the purchase card, and clause 52.232-33 will be superseded by clause 52.232-36. All sources wishing to provide a quotation must respond by 5:00 PM, July 6, 2020. Quotations should be addressed to USNPRC 950 College Station Rd, Athens, GA 30605. POC is Kelly Bero, Purchasing Agent, 706/546-3025. Please email to Kelly.Bero@usda.gov. All responses will be evaluated to determine the equipment’s capability to meet the above requirements.